PDB entry 4c9p

View 4c9p on RCSB PDB site
Description: Structure of camphor bound T260A mutant of CYP101D1
Class: oxidoreductase
Keywords: oxidoreductase, mono-oxygenase
Deposited on 2013-10-02, released 2013-12-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1699
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: NOVOSPHINGOBIUM AROMATICIVORANS [TaxId:48935]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2GB12
      • engineered mutation (259)
    Domains in SCOPe 2.03: d4c9pa_
  • Chain 'B':
    Compound: cytochrome p450
    Species: NOVOSPHINGOBIUM AROMATICIVORANS [TaxId:48935]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2GB12
      • engineered mutation (259)
    Domains in SCOPe 2.03: d4c9pb_
  • Heterogens: HEM, CAM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c9pA (A:)
    mnaqtstatqkhrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpf
    tgghwiatrgtlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkg
    lnlaeirkledqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklg
    llanemtrpsgntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkp
    mpddralglvsllllggldavvnflgfmmiylsrhpetvaemrreplklqrgveelfrrf
    avvsdaryvvsdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaq
    gphrcagmhlarlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepqrvs
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c9pA (A:)
    qkhrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpftgghwiatr
    gtlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkglnlaeirkl
    edqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklgllanemtrp
    sgntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkpmpddralgl
    vsllllggldavvnflgfmmiylsrhpetvaemrreplklqrgveelfrrfavvsdaryv
    vsdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaqgphrcagmh
    larlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4c9pB (B:)
    mnaqtstatqkhrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpf
    tgghwiatrgtlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkg
    lnlaeirkledqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklg
    llanemtrpsgntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkp
    mpddralglvsllllggldavvnflgfmmiylsrhpetvaemrreplklqrgveelfrrf
    avvsdaryvvsdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaq
    gphrcagmhlarlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepqrvs
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c9pB (B:)
    khrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpftgghwiatrg
    tlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkglnlaeirkle
    dqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklgllanemtrps
    gntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkpmpddralglv
    sllllggldavvnflgfmmiylsrhpetvaemrreplklqrgveelfrrfavvsdaryvv
    sdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaqgphrcagmhl
    arlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepq