PDB entry 4c9o

View 4c9o on RCSB PDB site
Description: Structure of Cyanide and Camphor bound D259N mutant of CYP101D1
Class: oxidoreductase
Keywords: oxidoreductase, mono-oxygenase, p450
Deposited on 2013-10-02, released 2013-12-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.1489
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: NOVOSPHINGOBIUM AROMATICIVORANS [TaxId:48935]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2GB12
      • engineered mutation (258)
    Domains in SCOPe 2.03: d4c9oa_
  • Chain 'B':
    Compound: cytochrome p450
    Species: NOVOSPHINGOBIUM AROMATICIVORANS [TaxId:48935]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2GB12
      • engineered mutation (258)
  • Heterogens: HEM, CAM, CYN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c9oA (A:)
    mnaqtstatqkhrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpf
    tgghwiatrgtlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkg
    lnlaeirkledqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklg
    llanemtrpsgntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkp
    mpddralglvsllllgglntvvnflgfmmiylsrhpetvaemrreplklqrgveelfrrf
    avvsdaryvvsdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaq
    gphrcagmhlarlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepqrvs
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c9oA (A:)
    qkhrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpftgghwiatr
    gtlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkglnlaeirkl
    edqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklgllanemtrp
    sgntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkpmpddralgl
    vsllllgglntvvnflgfmmiylsrhpetvaemrreplklqrgveelfrrfavvsdaryv
    vsdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaqgphrcagmh
    larlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepq
    

  • Chain 'B':
    No sequence available.