PDB entry 4c9n

View 4c9n on RCSB PDB site
Description: Structure of camphor and hydroxycamphor bound D259N mutant of CYP101D1
Class: oxidoreductase
Keywords: oxidoreductase, mono-oxygenase
Deposited on 2013-10-02, released 2013-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.1778
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: NOVOSPHINGOBIUM AROMATICIVORANS [TaxId:48935]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2GB12
      • engineered mutation (258)
    Domains in SCOPe 2.07: d4c9na_
  • Chain 'B':
    Compound: cytochrome p450
    Species: NOVOSPHINGOBIUM AROMATICIVORANS [TaxId:48935]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2GB12
      • engineered mutation (258)
    Domains in SCOPe 2.07: d4c9nb_
  • Heterogens: HEM, CAM, CAH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c9nA (A:)
    mnaqtstatqkhrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpf
    tgghwiatrgtlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkg
    lnlaeirkledqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklg
    llanemtrpsgntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkp
    mpddralglvsllllgglntvvnflgfmmiylsrhpetvaemrreplklqrgveelfrrf
    avvsdaryvvsdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaq
    gphrcagmhlarlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepqrvs
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c9nA (A:)
    qkhrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpftgghwiatr
    gtlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkglnlaeirkl
    edqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklgllanemtrp
    sgntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkpmpddralgl
    vsllllgglntvvnflgfmmiylsrhpetvaemrreplklqrgveelfrrfavvsdaryv
    vsdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaqgphrcagmh
    larlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4c9nB (B:)
    mnaqtstatqkhrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpf
    tgghwiatrgtlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkg
    lnlaeirkledqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklg
    llanemtrpsgntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkp
    mpddralglvsllllgglntvvnflgfmmiylsrhpetvaemrreplklqrgveelfrrf
    avvsdaryvvsdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaq
    gphrcagmhlarlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepqrvs
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c9nB (B:)
    khrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpftgghwiatrg
    tlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkglnlaeirkle
    dqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklgllanemtrps
    gntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkpmpddralglv
    sllllgglntvvnflgfmmiylsrhpetvaemrreplklqrgveelfrrfavvsdaryvv
    sdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaqgphrcagmhl
    arlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepq