PDB entry 4c9f

View 4c9f on RCSB PDB site
Description: Structure of SIGN-R1 in complex with Sulfodextran
Class: membrane protein
Keywords: membrane protein, c-type lectin, innate immunity
Deposited on 2013-10-02, released 2014-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.19322
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd209 antigen-like protein b
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c9fa_
  • Chain 'B':
    Compound: cd209 antigen-like protein b
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c9fb_
  • Chain 'C':
    Compound: cd209 antigen-like protein b
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c9fc_
  • Chain 'D':
    Compound: cd209 antigen-like protein b
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CJ91 (1-133)
      • expression tag (0)
    Domains in SCOPe 2.07: d4c9fd1, d4c9fd2
  • Heterogens: CA, SO4, GQ2, GQ4, GQ1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c9fA (A:)
    klcrlcpwdwtfllgncyffsksqrnwndavtackevkaqlviinsdeeqtflqqtskak
    gptwmglsdlkkeatwlwvdgstlssrfqkywnrgepnnigeedcvefagdgwndskcel
    kkfwickksatpct
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c9fA (A:)
    lcrlcpwdwtfllgncyffsksqrnwndavtackevkaqlviinsdeeqtflqqtskakg
    ptwmglsdlkkeatwlwvdgstlssrfqkywnrgepnnigeedcvefagdgwndskcelk
    kfwickksatpc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4c9fB (B:)
    klcrlcpwdwtfllgncyffsksqrnwndavtackevkaqlviinsdeeqtflqqtskak
    gptwmglsdlkkeatwlwvdgstlssrfqkywnrgepnnigeedcvefagdgwndskcel
    kkfwickksatpct
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c9fB (B:)
    lcrlcpwdwtfllgncyffsksqrnwndavtackevkaqlviinsdeeqtflqqtskakg
    ptwmglsdlkkeatwlwvdgstlssrfqkywnrgepnnigeedcvefagdgwndskcelk
    kfwickksatpct
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4c9fC (C:)
    klcrlcpwdwtfllgncyffsksqrnwndavtackevkaqlviinsdeeqtflqqtskak
    gptwmglsdlkkeatwlwvdgstlssrfqkywnrgepnnigeedcvefagdgwndskcel
    kkfwickksatpct
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c9fC (C:)
    lcrlcpwdwtfllgncyffsksqrnwndavtackevkaqlviinsdeeqtflqqtskakg
    ptwmglsdlkkeatwlwvdgstlssrfqkywnrgepnnigeedcvefagdgwndskcelk
    kfwickksatpc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c9fD (D:)
    klcrlcpwdwtfllgncyffsksqrnwndavtackevkaqlviinsdeeqtflqqtskak
    gptwmglsdlkkeatwlwvdgstlssrfqkywnrgepnnigeedcvefagdgwndskcel
    kkfwickksatpct