PDB entry 4c7p

View 4c7p on RCSB PDB site
Description: Crystal structure of Legionella pneumophila RalF F255K mutant
Class: signaling protein
Keywords: signaling protein
Deposited on 2013-09-24, released 2013-12-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.2059
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ralf
    Species: LEGIONELLA PNEUMOPHILA [TaxId:272624]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RT31 (29-End)
      • expression tag (28)
      • engineered mutation (282)
    Domains in SCOPe 2.04: d4c7pa1, d4c7pa2
  • Heterogens: GOL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c7pA (A:)
    msyyhhhhhhdydipttenlyfqgamgashpeiekaqreiieafnakpknginkikeice
    qykispneeiaeffhqqrknldleavgdylsspeaenqqvlkaftsqmnfngqsfveglr
    tflktfklpgeaqkidrlvqsfsgayfqqnpdvvsnadaayllafqtimlntdlhnpsip
    eknkmtvdglkrnlrggnnggdfdakfleelyseikakpfelnfvktspgyeltsttlnk
    dstfkkldsflhstdvnintvfpgigdnvkttvdqpkswlsfktgykgtitltdnktsaq
    atiqvytpnifskwlfgeqprviiqpgqtkesidlaakaaadfsspvknfkatydyevgd
    likaydnqkklitiernlalkegvpkdpdaemqkekgrqlkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c7pA (A:)
    shpeiekaqreiieafnakpknginkikeiceqykispneeiaeffhqqrknldleavgd
    ylsspeaenqqvlkaftsqmnfngqsfveglrtflktfklpgeaqkidrlvqsfsgayfq
    qnpdvvsnadaayllafqtimlntdlhnpsipeknkmtvdglkrnlrggnnggdfdakfl
    eelyseikakpfelnfvktspgyeltsttlnkdstfkkldsflhstdvnintvfpgigdn
    vkttvdqpkswlsfktgykgtitltdnktsaqatiqvytpnifskwlfgeqprviiqpgq
    tkesidlaakaaadfsspvknfkatydyevgdlikaydnqkklitie