PDB entry 4c6a

View 4c6a on RCSB PDB site
Description: High Resolution Structure of the Nucleoside diphosphate kinase
Class: transferase
Keywords: transferase, phosphotransferase
Deposited on 2013-09-18, released 2013-11-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.1638
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-153)
      • engineered mutation (120)
    Domains in SCOPe 2.03: d4c6aa_
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c6aA (A:)
    stnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehke
    rpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrnii
    ggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c6aA (A:)
    kvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpf
    fgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggs
    dsvesanreialwfkpeelltevkpnpnlye