PDB entry 4c4p

View 4c4p on RCSB PDB site
Description: Crystal Structure of Wild-Type Rab11 Complexed to FIP2
Class: protein transport
Keywords: protein transport, effector, vesicle trafficking, endosomes
Deposited on 2013-09-07, released 2013-09-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1826
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-11A
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4c4pa_
  • Chain 'B':
    Compound: Rab11 family-interacting protein 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c4pA (A:)
    mgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgkti
    kaqiwdtagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivim
    lvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c4pA (A:)
    eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
    tagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
    dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy
    

  • Chain 'B':
    No sequence available.