PDB entry 4c4c

View 4c4c on RCSB PDB site
Description: Michaelis complex of Hypocrea jecorina CEL7A E217Q mutant with cellononaose spanning the active site
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase, cellulase.
Deposited on 2013-09-05, released 2014-01-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: TRICHODERMA REESEI [TaxId:51453]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62694 (0-433)
      • cloning artifact (93)
      • engineered mutation (216)
    Domains in SCOPe 2.08: d4c4ca_
  • Heterogens: CO, NAG, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c4cA (A:)
    esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
    cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
    tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
    kfingqanvegwepssnnantgigghgsccsemdiwqansisealtphpcttvgqeiceg
    dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
    nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
    vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
    ikfgpigstgnpsg