PDB entry 4c45

View 4c45 on RCSB PDB site
Description: Crystal structure of human pterin-4-alpha-carbinolamine dehydratase 2 (PCBD2)
Class: lyase
Keywords: lyase
Deposited on 2013-08-30, released 2013-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pterin-4-alpha-carbinolamine dehydratase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4c45a_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c45A (A:)
    smssgthrltaeernqaildlkaagwselserdaiykefsfhnfnqafgfmsrvalqaek
    mnhhpewfnvynkvqitltshdcgeltkkdvklakfiekaaasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c45A (A:)
    thrltaeernqaildlkaagwselserdaiykefsfhnfnqafgfmsrvalqaekmnhhp
    ewfnvynkvqitltshdcgeltkkdvklakfiekaaasv