PDB entry 4c3z

View 4c3z on RCSB PDB site
Description: Nucleotide-free crystal structure of nucleotide-binding domain 1 from human MRP1 supports a general-base catalysis mechanism for ATP hydrolysis.
Class: transport protein
Keywords: transport protein, ATP-binding cassette transporters, multidrug resistance protein 1, general-base mechanism
Deposited on 2013-08-28, released 2014-09-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: multidrug resistance-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4c3za_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c3zA (A:)
    marihhhhhhgsdsierrpvkdgggtnsitvrnatftwarsdpptlngitfsipegalva
    vvgqvgcgkssllsallaemdkveghvaikgsvayvpqqawiqndslrenilfgcqleep
    yyrsviqacallpdleilpsgdrteigekgvnlsggqkqrvslaravysnadiylfddpl
    savdahvgkhifenvigpkgmlknktrilvthsmsylpqvdviivmsggkisemgsyqel
    lardgafaeflrtyasteqeqdaeen
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3zA (A:)
    tnsitvrnatftwarsdpptlngitfsipegalvavvgqvgcgkssllsallaemdkveg
    hvaikgsvayvpqqawiqndslrenilfgcqleepyyrsviqacallpdleilpsgdrte
    igekgvnlsggqkqrvslaravysnadiylfddplsavdahvgkhifenvigpkgmlknk
    trilvthsmsylpqvdviivmsggkisemgsyqellardgafaeflrtyas