PDB entry 4c3t

View 4c3t on RCSB PDB site
Description: The Carbonic anhydrase from Thermovibrio ammonificans reveals an interesting intermolecular disulfide contributing to increasing thermal stability of this enzyme
Class: lyase
Keywords: lyase, thermophilic, acetazolamide, carbon dioxide capture, thermal stability
Deposited on 2013-08-27, released 2014-09-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.22284
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonate dehydratase
    Species: THERMOVIBRIO AMMONIFICANS [TaxId:228745]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4c3ta_
  • Chain 'B':
    Compound: Carbonate dehydratase
    Species: THERMOVIBRIO AMMONIFICANS [TaxId:228745]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4c3tb_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c3tA (A:)
    mkrvlvtlgavaalatgavagggahwgysgsigpehwgdlspeylmckigknqspidins
    adavkaclapvsvyyvsdakyvvnnghtikvvmggrgyvvvdgkrfylkqfhfhapseht
    vngkhypfeahfvhldkngnitvlgvffkvgkenpelekvwrvmpeepgqkrhltaridp
    ekllpenrdyyrysgslttppcsegvrwivfkepvemsreqlekfrkvmgfdnnrpvqpl
    narkvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3tA (A:)
    gahwgysgsigpehwgdlspeylmckigknqspidinsadavkaclapvsvyyvsdakyv
    vnnghtikvvmggrgyvvvdgkrfylkqfhfhapsehtvngkhypfeahfvhldkngnit
    vlgvffkvgkenpelekvwrvmpeepgqkrhltaridpekllpenrdyyrysgslttppc
    segvrwivfkepvemsreqlekfrkvmgfdnnrpvqplnarkvmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4c3tB (B:)
    mkrvlvtlgavaalatgavagggahwgysgsigpehwgdlspeylmckigknqspidins
    adavkaclapvsvyyvsdakyvvnnghtikvvmggrgyvvvdgkrfylkqfhfhapseht
    vngkhypfeahfvhldkngnitvlgvffkvgkenpelekvwrvmpeepgqkrhltaridp
    ekllpenrdyyrysgslttppcsegvrwivfkepvemsreqlekfrkvmgfdnnrpvqpl
    narkvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3tB (B:)
    gahwgysgsigpehwgdlspeylmckigknqspidinsadavkaclapvsvyyvsdakyv
    vnnghtikvvmggrgyvvvdgkrfylkqfhfhapsehtvngkhypfeahfvhldkngnit
    vlgvffkvgkenpelekvwrvmpeepgqkrhltaridpekllpenrdyyrysgslttppc
    segvrwivfkepvemsreqlekfrkvmgfdnnrpvqplnarkvmk