PDB entry 4c3k

View 4c3k on RCSB PDB site
Description: Structure of mixed PII-ADP complexes from S. elongatus
Class: transcription
Keywords: transcription
Deposited on 2013-08-25, released 2014-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.2169
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen regulatory protein p-II
    Species: Synechococcus elongatus [TaxId:32046]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • expression tag (112-114)
    Domains in SCOPe 2.06: d4c3ka1, d4c3ka2
  • Chain 'B':
    Compound: nitrogen regulatory protein p-II
    Species: Synechococcus elongatus [TaxId:32046]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4c3kb_
  • Chain 'C':
    Compound: nitrogen regulatory protein p-II
    Species: Synechococcus elongatus [TaxId:32046]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4c3kc_
  • Chain 'D':
    Compound: nitrogen regulatory protein p-II
    Species: Synechococcus elongatus [TaxId:32046]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • expression tag (112-114)
    Domains in SCOPe 2.06: d4c3kd1, d4c3kd2
  • Chain 'E':
    Compound: nitrogen regulatory protein p-II
    Species: Synechococcus elongatus [TaxId:32046]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4c3ke_
  • Chain 'F':
    Compound: nitrogen regulatory protein p-II
    Species: Synechococcus elongatus [TaxId:32046]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • expression tag (112-113)
    Domains in SCOPe 2.06: d4c3kf1, d4c3kf2
  • Heterogens: PO4, ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c3kA (A:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3kA (A:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfeflqklkleivvedaqvdtvidki
    vaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4c3kB (B:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3kB (B:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfflqklkleivvedaqvdtvidkiv
    aaartgeigdgkifvspvdqtirirtgekn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4c3kC (C:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3kC (C:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqeytveflqklkleivvedaqv
    dtvidkivaaartgeigdgkifvspvdqtirirtgekn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4c3kD (D:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3kD (D:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrveflqklkleivvedaqvdtvi
    dkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4c3kE (E:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3kE (E:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgreflqklkleivvedaqvdtvid
    kivaaartgeigdgkifvspvdqtirirtgeknada
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4c3kF (F:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3kF (F:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgytveflqklkleivvedaq
    vdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisa