PDB entry 4c3i

View 4c3i on RCSB PDB site
Description: Structure of 14-subunit RNA polymerase I at 3.0 A resolution, crystal form C2-100
Class: transferase
Keywords: transferase
Deposited on 2013-08-24, released 2013-10-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.2001
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase I subunit rpa190
    Species: SACCHAROMYCES CEREVISIAE
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA-directed RNA polymerase I subunit rpa135
    Species: SACCHAROMYCES CEREVISIAE
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA-directed RNA polymerases I and III subunit rpac1
    Species: SACCHAROMYCES CEREVISIAE
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: DNA-directed RNA polymerase I subunit rpa14
    Species: SACCHAROMYCES CEREVISIAE
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50106
      • conflict (11)
  • Chain 'E':
    Compound: DNA-directed RNA polymerases I, II, and III subunit rpabc 1
    Species: SACCHAROMYCES CEREVISIAE
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4c3ie1, d4c3ie2
  • Chain 'F':
    Compound: DNA-directed RNA polymerases I, II, and III subunit rpabc 2
    Species: SACCHAROMYCES CEREVISIAE
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4c3if_
  • Chain 'G':
    Compound: DNA-directed RNA polymerase I subunit rpa43
    Species: SACCHAROMYCES CEREVISIAE
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: DNA-directed RNA polymerases I, II, and III subunit rpabc 3
    Species: SACCHAROMYCES CEREVISIAE
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4c3ih_
  • Chain 'I':
    Compound: DNA-directed RNA polymerase I subunit rpa12
    Species: SACCHAROMYCES CEREVISIAE
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: DNA-directed RNA polymerases I, II, and III subunit rpabc 5
    Species: SACCHAROMYCES CEREVISIAE
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4c3ij_
  • Chain 'K':
    Compound: DNA-directed RNA polymerases I and III subunit rpac2
    Species: SACCHAROMYCES CEREVISIAE
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4c3ik_
  • Chain 'L':
    Compound: DNA-directed RNA polymerases I, II, and III subunit rpabc 4
    Species: SACCHAROMYCES CEREVISIAE
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4c3il_
  • Chain 'M':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: SACCHAROMYCES CEREVISIAE
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: DNA-directed RNA polymerase I subunit RPA34
    Species: SACCHAROMYCES CEREVISIAE
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, ZN, MG, MPD

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c3iE (E:)
    mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
    qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
    mklvpsippatietfneaalvvnithhelvpkhirlssdekrellkryrlkesqlpriqr
    adpvalylglkrgevvkiirksetsgryasyricm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4c3iF (F:)
    msdyeeafndgnenfedfdvehfsdeetyeekpqfkdgettdangktivtggngpedfqq
    heqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplri
    amkelaekkiplvirrylpdgsfedwsveelivdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3iF (F:)
    pedfqqheqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlege
    tdplriamkelaekkiplvirrylpdgsfedwsveelivd
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4c3iH (H:)
    msntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtia
    sslnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfgg
    llmrlegnyrnlnnlkqenayllirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3iH (H:)
    ntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtiass
    lnatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnl
    nnlkqenayllirr
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4c3iJ (J:)
    mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
    lrynplekrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3iJ (J:)
    mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
    lrynplekr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4c3iK (K:)
    mtedieqkktatevtpqepkhiqeeeeqdvdmtgdeeqeeepdrekiklltqatsedgts
    asfqiveedhtlgnalryvimknpdvefcgysiphpsenllniriqtygettavdalqkg
    lkdlmdlcdvveskftekiksm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3iK (K:)
    eepdrekiklltqatsedgtsasfqiveedhtlgnalryvimknpdvefcgysiphpsen
    llniriqtygettavdalqkglkdlmdlcdvveskftekiksm
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4c3iL (L:)
    msregfqiptnldaaaagtsqartatlkyicaecssklslsrtdavrckdcghrillkar
    tkrlvqfear
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3iL (L:)
    tlkyicaecssklslsrtdavrckdcghrillkartkrlvqfear
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.