PDB entry 4c3f

View 4c3f on RCSB PDB site
Description: Structure of Lck in complex with a compound discovered by Virtual Fragment Linking
Class: transferase
Keywords: transferase
Deposited on 2013-08-23, released 2013-10-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.17953
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase Lck
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239
      • engineered mutation (129)
    Domains in SCOPe 2.06: d4c3fa_
  • Heterogens: 7KW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c3fA (A:)
    gpewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanlmkq
    lqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmaf
    ieernyihrnlraanilvsdtlsckiadfglarliedneytaregakfpikwtapeainy
    gtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmr
    lcwkerpedrptfdylrsvledfftat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c3fA (A:)
    wevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanlmkqlqh
    qrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafiee
    rnyihrnlraanilvsdtlsckiadfglarliedneytarfpikwtapeainygtftiks
    dvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrlcwkerp
    edrptfdylrsvledff