PDB entry 4c2b

View 4c2b on RCSB PDB site
Description: Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation in Complex with High Affinity GPIb alpha
Class: blood clotting
Keywords: blood clotting
Deposited on 2013-08-16, released 2014-01-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2566
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04275
      • engineered mutation (8-9)
      • variant (118)
    Domains in SCOPe 2.06: d4c2ba_
  • Chain 'B':
    Compound: platelet glycoprotein ib alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07359
      • engineered mutation (20)
      • engineered mutation (158)
      • engineered mutation (232)
      • engineered mutation (238)
    Domains in SCOPe 2.06: d4c2bb_
  • Chain 'C':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04275
      • engineered mutation (8-9)
      • variant (118)
    Domains in SCOPe 2.06: d4c2bc_
  • Chain 'D':
    Compound: platelet glycoprotein ib alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07359
      • engineered mutation (20)
      • engineered mutation (158)
      • engineered mutation (232)
      • engineered mutation (238)
    Domains in SCOPe 2.06: d4c2bd_
  • Chain 'E':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04275
      • engineered mutation (8-9)
      • variant (118)
    Domains in SCOPe 2.06: d4c2be_
  • Chain 'F':
    Compound: platelet glycoprotein ib alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07359
      • engineered mutation (20)
      • engineered mutation (158)
      • engineered mutation (232)
      • engineered mutation (238)
    Domains in SCOPe 2.06: d4c2bf_
  • Chain 'G':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04275
      • engineered mutation (8-9)
      • variant (118)
    Domains in SCOPe 2.06: d4c2bg_
  • Chain 'H':
    Compound: platelet glycoprotein ib alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07359
      • engineered mutation (20)
      • engineered mutation (158)
      • engineered mutation (232)
      • engineered mutation (238)
    Domains in SCOPe 2.06: d4c2bh_
  • Heterogens: SO4, MES, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c2bA (A:)
    mepplhdfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyh
    dgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrial
    llmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlss
    vdeleqqrdeivsylcdlapeappptlpphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2bA (A:)
    lhdfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgsh
    ayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllma
    sqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdel
    eqqrdeivsylcdlapeap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4c2bB (B:)
    hpicevskvashlevncdkrrltalppdlpkdttilhlsenllytfslatlmpytrltql
    nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
    rglgelqelylkgnelktlppglltptpkleklslannrltelpagllnglenldtlllq
    enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqvvdvkavt
    snvasvqcdnsdkfpvykypgkgcptlgdegdtdlydyypeedtegdkvrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2bB (B:)
    picevskvashlevncdkrrltalppdlpkdttilhlsenllytfslatlmpytrltqln
    ldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgalr
    glgelqelylkgnelktlppglltptpkleklslannrltelpagllnglenldtlllqe
    nslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqvvdvkavts
    nvasvqcdnsdkfpvykypgkgcp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4c2bC (C:)
    mepplhdfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyh
    dgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrial
    llmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlss
    vdeleqqrdeivsylcdlapeappptlpphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2bC (C:)
    hdfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgsha
    yiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmas
    qepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdele
    qqrdeivsylcdlapeapp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4c2bD (D:)
    hpicevskvashlevncdkrrltalppdlpkdttilhlsenllytfslatlmpytrltql
    nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
    rglgelqelylkgnelktlppglltptpkleklslannrltelpagllnglenldtlllq
    enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqvvdvkavt
    snvasvqcdnsdkfpvykypgkgcptlgdegdtdlydyypeedtegdkvrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2bD (D:)
    picevskvashlevncdkrrltalppdlpkdttilhlsenllytfslatlmpytrltqln
    ldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgalr
    glgelqelylkgnelktlppglltptpkleklslannrltelpagllnglenldtlllqe
    nslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqvvdvkavts
    nvasvqcdnkfpvykypgkgcp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4c2bE (E:)
    mepplhdfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyh
    dgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrial
    llmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlss
    vdeleqqrdeivsylcdlapeappptlpphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2bE (E:)
    lhdfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgsh
    ayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllma
    sqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdel
    eqqrdeivsylcdlapeap
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4c2bF (F:)
    hpicevskvashlevncdkrrltalppdlpkdttilhlsenllytfslatlmpytrltql
    nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
    rglgelqelylkgnelktlppglltptpkleklslannrltelpagllnglenldtlllq
    enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqvvdvkavt
    snvasvqcdnsdkfpvykypgkgcptlgdegdtdlydyypeedtegdkvrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2bF (F:)
    picevskvashlevncdkrrltalppdlpkdttilhlsenllytfslatlmpytrltqln
    ldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgalr
    glgelqelylkgnelktlppglltptpkleklslannrltelpagllnglenldtlllqe
    nslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqvvdvkavts
    nvasvqcdnsdkfpvykypgkgcp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4c2bG (G:)
    mepplhdfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyh
    dgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrial
    llmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlss
    vdeleqqrdeivsylcdlapeappptlpphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2bG (G:)
    dfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgshay
    iglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasq
    epqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleq
    qrdeivsylcdlapeap
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4c2bH (H:)
    hpicevskvashlevncdkrrltalppdlpkdttilhlsenllytfslatlmpytrltql
    nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
    rglgelqelylkgnelktlppglltptpkleklslannrltelpagllnglenldtlllq
    enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqvvdvkavt
    snvasvqcdnsdkfpvykypgkgcptlgdegdtdlydyypeedtegdkvrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2bH (H:)
    icevskvashlevncdkrrltalppdlpkdttilhlsenllytfslatlmpytrltqlnl
    drceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgalrg
    lgelqelylkgnelktlppglltptpkleklslannrltelpagllnglenldtlllqen
    slytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqvvdvkavtsn
    vasvqcddkfpvykypgkgcp