PDB entry 4c2a

View 4c2a on RCSB PDB site
Description: Crystal Structure of High-Affinity von Willebrand Factor A1 domain with R1306Q and I1309V Mutations in Complex with High Affinity GPIb alpha
Class: blood clotting
Keywords: blood clotting, cell adhesion, a1, gpibalpha
Deposited on 2013-08-16, released 2014-01-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04275
      • engineered mutation (43)
      • engineered mutation (46)
      • variant (118)
    Domains in SCOPe 2.07: d4c2aa_
  • Chain 'B':
    Compound: platelet glycoprotein ib alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07359 (0-End)
      • engineered mutation (20)
      • engineered mutation (158)
      • engineered mutation (232)
      • engineered mutation (238)
    Domains in SCOPe 2.07: d4c2ab_
  • Heterogens: CAC, ACT, CA, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c2aA (A:)
    mepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmeqlrvsqkwvrvavveyh
    dgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrial
    llmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlss
    vdeleqqrdeivsylcdlapeappptlpphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2aA (A:)
    plhdfycsrlldlvflldgssrlseaefevlkafvvdmmeqlrvsqkwvrvavveyhdgs
    hayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllm
    asqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvde
    leqqrdeivsylcdlapeappp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4c2aB (B:)
    hpicevskvashlevncdkrrltalppdlpkdttilhlsenllytfslatlmpytrltql
    nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
    rglgelqelylkgnelktlppglltptpkleklslannrltelpagllnglenldtlllq
    enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqvvdvkavt
    snvasvqcdnsdkfpvykypgkgcptlgdegdtdlydyypeedtegdkvrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2aB (B:)
    hpicevskvashlevncdkrrltalppdlpkdttilhlsenllytfslatlmpytrltql
    nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
    rglgelqelylkgnelktlppglltptpkleklslannrltelpagllnglenldtlllq
    enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqvvdvkavt
    snvasvqcdnsdkfpvykypgkgcpt