PDB entry 4c29

View 4c29 on RCSB PDB site
Description: Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation
Class: blood clotting
Keywords: blood clotting, cell adhesion
Deposited on 2013-08-16, released 2014-01-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.1881
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04275
      • engineered mutation (8-9)
      • variant (118)
    Domains in SCOPe 2.06: d4c29a_
  • Chain 'B':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04275
      • engineered mutation (8-9)
      • variant (118)
    Domains in SCOPe 2.06: d4c29b_
  • Heterogens: ACT, PEG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c29A (A:)
    mepplhdfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyh
    dgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrial
    llmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlss
    vdeleqqrdeivsylcdlapeappptlpphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c29A (A:)
    plhdfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgs
    hayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllm
    asqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvde
    leqqrdeivsylcdlapeapp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4c29B (B:)
    mepplhdfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyh
    dgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrial
    llmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlss
    vdeleqqrdeivsylcdlapeappptlpphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c29B (B:)
    plhdfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgs
    hayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllm
    asqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvde
    leqqrdeivsylcdlapeapp