PDB entry 4c20

View 4c20 on RCSB PDB site
Description: L-Fucose Isomerase
Class: isomerase
Keywords: fucose processing, isomerase
Deposited on 2013-08-16, released 2013-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.15596
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-fucose isomerase
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c20a1, d4c20a2
  • Chain 'B':
    Compound: l-fucose isomerase
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97N97 (18-604)
      • expression tag (0-17)
    Domains in SCOPe 2.07: d4c20b1, d4c20b2, d4c20b3
  • Heterogens: MN, EDO, SO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c20A (A:)
    hhhhhssglvprgshmasiqhprigirptidgrrqgvreslevqtmnmaksvadlisstl
    kypdgepvecvispstigrvpeaaashelfkksnvcatitvtpcwcygsetmdmspdiph
    aiwgfngterpgavylaavlashaqkgipafgiygrdvqeasdtdipedvkekllryara
    alatglmrdtaylsmgsvsmgiggsivnpdffqeylgmrnesvdmteftrrmdrgiydpe
    eferalkwvkenvkegfdhnredlvlsreekdrqwefvikmfmigrdlmvgnprlaelgf
    eeeavghhalvagfqgqrqwtdhfpngdfmetflntqfdwngirkpfvfatendslngvs
    mlfnylltntpqifadvrtywspeavkrvtghtlegraaagflhlinsgsctldgtgqat
    rdgkpimkpfweleesevqamlentdfppanreyfrgggfstrfltkgdmpvtmvrlnll
    kgvgpvlqiaegytlelpedvhhtldnrtdpgwpttwfaprltgkgafksvydvmnnwga
    nhgaityghigadlitlasmlripvnmhnvpeedifrpknwslfgtedlesadyracqll
    gplhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c20A (A:)
    iqhprigirptidgrrqgvreslevqtmnmaksvadlisstlkypdgepvecvispstig
    rvpeaaashelfkksnvcatitvtpcwcygsetmdmspdiphaiwgfngterpgavylaa
    vlashaqkgipafgiygrdvqeasdtdipedvkekllryaraalatglmrdtaylsmgsv
    smgiggsivnpdffqeylgmrnesvdmteftrrmdrgiydpeeferalkwvkenvkegfd
    hnredlvlsreekdrqwefvikmfmigrdlmvgnprlaelgfeeeavghhalvagfqgqr
    qwtdhfpngdfmetflntqfdwngirkpfvfatendslngvsmlfnylltntpqifadvr
    tywspeavkrvtghtlegraaagflhlinsgsctldgtgqatrdgkpimkpfweleesev
    qamlentdfppanreyfrgggfstrfltkgdmpvtmvrlnllkgvgpvlqiaegytlelp
    edvhhtldnrtdpgwpttwfaprltgkgafksvydvmnnwganhgaityghigadlitla
    smlripvnmhnvpeedifrpknwslfgtedlesadyracqllgplhk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c20B (B:)
    hhhhhssglvprgshmasiqhprigirptidgrrqgvreslevqtmnmaksvadlisstl
    kypdgepvecvispstigrvpeaaashelfkksnvcatitvtpcwcygsetmdmspdiph
    aiwgfngterpgavylaavlashaqkgipafgiygrdvqeasdtdipedvkekllryara
    alatglmrdtaylsmgsvsmgiggsivnpdffqeylgmrnesvdmteftrrmdrgiydpe
    eferalkwvkenvkegfdhnredlvlsreekdrqwefvikmfmigrdlmvgnprlaelgf
    eeeavghhalvagfqgqrqwtdhfpngdfmetflntqfdwngirkpfvfatendslngvs
    mlfnylltntpqifadvrtywspeavkrvtghtlegraaagflhlinsgsctldgtgqat
    rdgkpimkpfweleesevqamlentdfppanreyfrgggfstrfltkgdmpvtmvrlnll
    kgvgpvlqiaegytlelpedvhhtldnrtdpgwpttwfaprltgkgafksvydvmnnwga
    nhgaityghigadlitlasmlripvnmhnvpeedifrpknwslfgtedlesadyracqll
    gplhk