PDB entry 4c0s

View 4c0s on RCSB PDB site
Description: Mammalian translation elongation factor eEF1A2
Class: translation
Keywords: translation
Deposited on 2013-08-07, released 2014-08-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 1-alpha 2
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c0sa1, d4c0sa2, d4c0sa3
  • Chain 'B':
    Compound: Elongation factor 1-alpha 2
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c0sb1, d4c0sb2, d4c0sb3
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c0sA (A:)
    mgkekthinivvighvdsgkstttghliykcggidkrtiekfekeaaemgkgsfkyawvl
    dklkaerergitidislwkfettkyyitiidapghrdfiknmitgtsqadcavlivaagv
    gefeagiskngqtrehallaytlgvkqlivgvnkmdstepaysekrydeivkevsayikk
    igynpatvpfvpisgwhgdnmlepspnmpwfkgwkverkegnasgvsllealdtilpptr
    ptdkplrlplqdvykiggigtvpvgrvetgilrpgmvvtfapvnittevksvemhheals
    ealpgdnvgfnvknvsvkdirrgnvcgdsksdppqeaaqftsqviilnhpgqisagyspv
    idchtahiackfaelkekidrrsgkklednpkslksgdaaivemvpgkpmcvesfsqypp
    lgrfavrdmrqtvavgviknvekksggagkvtksaqkaqkagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c0sA (A:)
    ekthinivvighvdsgkstttghliykcggidkrtiekfekeaaemkgsfkyawvldklk
    aerergitidislwkfettkyyitiidapghrdfiknmitgtsqadcavlivaagvgefe
    agiskngqtrehallaytlgvkqlivgvnkmdstepaysekrydeivkevsayikkigyn
    patvpfvpisgwhgdnmlepspnmpwfkgwkverkegnasgvsllealdtilpptrptdk
    plrlplqdvykiggigtvpvgrvetgilrpgmvvtfapvnittevksvemhhealsealp
    gdnvgfnvknvsvkdirrgnvcgdsksdppqeaaqftsqviilnhpgqisagyspvidch
    tahiackfaelkekidrrsgkklednpkslksgdaaivemvpgkpmcvesfsqypplgrf
    avrdmrqtvavgviknvekksggagkvtksa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4c0sB (B:)
    mgkekthinivvighvdsgkstttghliykcggidkrtiekfekeaaemgkgsfkyawvl
    dklkaerergitidislwkfettkyyitiidapghrdfiknmitgtsqadcavlivaagv
    gefeagiskngqtrehallaytlgvkqlivgvnkmdstepaysekrydeivkevsayikk
    igynpatvpfvpisgwhgdnmlepspnmpwfkgwkverkegnasgvsllealdtilpptr
    ptdkplrlplqdvykiggigtvpvgrvetgilrpgmvvtfapvnittevksvemhheals
    ealpgdnvgfnvknvsvkdirrgnvcgdsksdppqeaaqftsqviilnhpgqisagyspv
    idchtahiackfaelkekidrrsgkklednpkslksgdaaivemvpgkpmcvesfsqypp
    lgrfavrdmrqtvavgviknvekksggagkvtksaqkaqkagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c0sB (B:)
    ekthinivvighvdsgkstttghliykcggidkrtiekfekeaaemgkgsfkyawvldkl
    kaerergitidislwkfettkyyitiidapghrdfiknmitgtsqadcavlivaagvgef
    eagiskngqtrehallaytlgvkqlivgvnkmdstepaysekrydeivkevsayikkigy
    npatvpfvpisgwhgdnmlepspnmpwfkgwkverkegnasgvsllealdtilpptrptd
    kplrlplqdvykiggigtvpvgrvetgilrpgmvvtfapvnittevksvemhhealseal
    pgdnvgfnvknvsvkdirrgnvcgdsksdppqeaaqftsqviilnhpgqisagyspvidc
    htahiackfaelkekidrrsgkklednpkslksgdaaivemvpgkpmcvesfsqypplgr
    favrdmrqtvavgviknvekks