PDB entry 4c02

View 4c02 on RCSB PDB site
Description: Crystal structure of human ACVR1 (ALK2) in complex with FKBP12.6 and dorsomorphin
Class: transferase/isomerase
Keywords: transferase-isomerase complex, transferase, dorsomorphin,
Deposited on 2013-07-31, released 2013-08-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.17833
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activin receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4c02a_
  • Chain 'B':
    Compound: peptidyl-prolyl cis-trans isomerase fkbp1b
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4c02b_
  • Heterogens: FLC, TAK, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c02A (A:)
    smttnvgdstladlldhsctsgsgsglpflvqrtvarqitllecvgkgrygevwrgswqg
    envavkifssrdekswfretelyntvmlrhenilgfiasdmtsrhsstqlwlithyhemg
    slydylqlttldtvsclrivlsiasglahlhieifgtqgkpaiahrdlksknilvkkngq
    cciadlglavmhsqstnqldvgnnprvgtkrymapevldetiqvdcfdsykrvdiwafgl
    vlwevarrmvsngivedykppfydvvpndpsfedmrkvvcvdqqrpnipnrwfsdptlts
    laklmkecwyqnpsarltalrikktltkid
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c02A (A:)
    stladlldsgsgsglpflvqrtvarqitllecvgkgrygevwrgswqgenvavkifssrd
    ekswfretelyntvmlrhenilgfiasdmtsrstqlwlithyhemgslydylqlttldtv
    sclrivlsiasglahlhieifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsq
    stnqldvprvgtkrymapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngived
    ykppfydvvpndpsfedmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarl
    talrikktltkid
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c02B (B:)
    mgveietispgdgrtfpkkgqtcvvhytgmlqngkkfdssrdrnkpfkfrigkqevikgf
    eegaaqmslgqrakltctpdvaygatghpgvippnatlifdvellnle