PDB entry 4bzo

View 4bzo on RCSB PDB site
Description: Crystal structure of PIM1 in complex with a Pyrrolo-Pyrazinone inhibitor
Class: transferase
Keywords: pim1, ATP binding, kinase inhibitor, transferase
Deposited on 2013-07-29, released 2013-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18315
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4bzoa_
  • Heterogens: 676, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bzoA (A:)
    gpllskinslahlraapcndlhatklapgkekeplesqyqvgpllgsggfgsvysgirvs
    dnlpvaikhvekdrisdwgelpngtrvpmevvllkkvssgfsgvirlldwferpdsfvli
    lerpepvqdlfdfitergalqeelarsffwqvleavrhchncgvlhrdikdenilidlnr
    gelklidfgsgallkdtvytdfdgtrvysppewiryhryhgrsaavwslgillydmvcgd
    ipfehdeeiirgqvffrqrvssecqhlirwclalrpsdrptfeeiqnhpwmqdvllpqet
    aeihlhslspgpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bzoA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh