PDB entry 4bz2
View 4bz2 on RCSB PDB site
Description: Structure of dengue virus EDIII in complex with Fab 2D73
Class: immune system-viral protein complex
Keywords: immune system-viral protein complex, immune system, antibody, immunoglobulin, fusion loop, virion
Deposited on
2013-07-23, released
2014-08-13
The last revision prior to the SCOPe 2.06 freeze date was dated
2014-08-13, with a file datestamp of
2014-08-08.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.2062
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: envelope protein
Species: DENGUE VIRUS 4 [TaxId:11070]
Database cross-references and differences (RAF-indexed):
- Uniprot Q7TGC7 (5-98)
- expression tag (0-4)
- expression tag (99-100)
Domains in SCOPe 2.06: d4bz2a1, d4bz2a2, d4bz2a3 - Chain 'H':
Compound: fab 2d73 heavy chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: fab 2d73 light chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4bz2l1, d4bz2l2 - Heterogens: NA, CL, PEG, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4bz2A (A:)
vefkrmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisst
pfaeytnsvtnieleppfgdsyivigvgdsaltlhwfrkhh
- Chain 'H':
No sequence available.
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>4bz2L (L:)
dikmtqspssmyaslgervtitckasqginsdlswfqqkpgkspktliyranrlvdgvps
rfsgsgsgqdysltissleyedmgiyyclqydefpltfgagtklelkradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrn