PDB entry 4bz2

View 4bz2 on RCSB PDB site
Description: Structure of dengue virus EDIII in complex with Fab 2D73
Class: immune system-viral protein complex
Keywords: immune system-viral protein complex, immune system, antibody, immunoglobulin, fusion loop, virion
Deposited on 2013-07-23, released 2014-08-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.2062
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope protein
    Species: DENGUE VIRUS 4 [TaxId:11070]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7TGC7 (5-98)
      • expression tag (0-4)
      • expression tag (99-100)
    Domains in SCOPe 2.06: d4bz2a1, d4bz2a2, d4bz2a3
  • Chain 'H':
    Compound: fab 2d73 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4BZ2 (0-220)
  • Chain 'L':
    Compound: fab 2d73 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4BZ2 (0-211)
    Domains in SCOPe 2.06: d4bz2l1, d4bz2l2
  • Heterogens: NA, CL, PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bz2A (A:)
    vefkrmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisst
    pfaeytnsvtnieleppfgdsyivigvgdsaltlhwfrkhh
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bz2L (L:)
    dikmtqspssmyaslgervtitckasqginsdlswfqqkpgkspktliyranrlvdgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn