PDB entry 4bz1

View 4bz1 on RCSB PDB site
Description: Structure of dengue virus EDIII in complex with Fab 3e31
Class: immune system/viral protein
Keywords: immune system-viral protein complex, fusion loop, virion
Deposited on 2013-07-23, released 2014-08-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.225
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope protein
    Species: DENGUE VIRUS 4 [TaxId:11070]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7TGC7 (0-93)
      • expression tag (94-95)
    Domains in SCOPe 2.06: d4bz1a1, d4bz1a2
  • Chain 'H':
    Compound: fab 3e31 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4BZ1 (0-216)
  • Chain 'L':
    Compound: fab 3e31 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4BZ1 (0-217)
    Domains in SCOPe 2.06: d4bz1l1, d4bz1l2
  • Heterogens: GOL, NA, ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4bz1A (A:)
mcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpfaey
tnsvtnieleppfgdsyivigvgdsaltlhwfrkhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4bz1A (A:)
mcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpfaey
tnsvtnieleppfgdsyivigvgdsaltlhwfrkhh

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4bz1L (L:)
divmsqspsslavsvgekvtlsckssqsllyssnqknhlawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltinsvkaedlavyycqhfyiypytfgggtkleikradaapt
vsifppsseqltsggasvvcflnnfapkdinvkwkidgserqngvlnswtdqdskdstys
msstltltkdeyerhnsytceathktstspivksfnrn