PDB entry 4by5

View 4by5 on RCSB PDB site
Description: Crystal structure of Drosophila Frq2
Class: calcium-binding protein
Keywords: calcium-binding protein, calcium sensor
Deposited on 2013-07-17, released 2014-08-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.21366
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fi18190p1
    Species: Drosophila melanogaster [TaxId:7227]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VWX8
      • engineered mutation (177)
    Domains in SCOPe 2.07: d4by5a_
  • Chain 'B':
    Compound: fi18190p1
    Species: Drosophila melanogaster [TaxId:7227]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VWX8
      • engineered mutation (177)
    Domains in SCOPe 2.07: d4by5b_
  • Chain 'C':
    Compound: fi18190p1
    Species: Drosophila melanogaster [TaxId:7227]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VWX8
      • engineered mutation (177)
    Domains in SCOPe 2.07: d4by5c_
  • Chain 'D':
    Compound: fi18190p1
    Species: Drosophila melanogaster [TaxId:7227]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VWX8
      • engineered mutation (177)
    Domains in SCOPe 2.07: d4by5d_
  • Heterogens: CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4by5A (A:)
    mgkknsklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgd
    pskfaslvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitree
    mynivdaiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvq
    alslggd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4by5A (A:)
    nsklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskf
    aslvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemyni
    vdaiyqmvgqntpqkrvdkifdqmdknhddrltleefregskadprmvqal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4by5B (B:)
    mgkknsklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgd
    pskfaslvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitree
    mynivdaiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvq
    alslggd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4by5B (B:)
    nsklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskf
    aslvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemyni
    vdaiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvqalsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4by5C (C:)
    mgkknsklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgd
    pskfaslvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitree
    mynivdaiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvq
    alslggd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4by5C (C:)
    klkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskfas
    lvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemynivd
    aiyqmvgtpqkrvdkifdqmdknhddrltleefregskadprmvqalsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4by5D (D:)
    mgkknsklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgd
    pskfaslvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitree
    mynivdaiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvq
    alslggd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4by5D (D:)
    klkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskfas
    lvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemynivd
    aiyqmvpqkrvdkifdqmdknhddrltleefregskadprmvqal