PDB entry 4bxv

View 4bxv on RCSB PDB site
Description: Three-dimensional structure of the mutant K109A of Paracoccus pantotrophus pseudoazurin at pH 7.0
Class: electron transport
Keywords: electron transport
Deposited on 2013-07-15, released 2014-07-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.2782
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80401 (0-122)
      • engineered mutation (108)
    Domains in SCOPe 2.07: d4bxva_
  • Chain 'B':
    Compound: pseudoazurin
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80401 (0-122)
      • engineered mutation (108)
    Domains in SCOPe 2.07: d4bxvb_
  • Heterogens: CU, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bxvA (A:)
    athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
    nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpakarermdaela
    qvn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bxvB (B:)
    athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
    nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpakarermdaela
    qvn