PDB entry 4bx5

View 4bx5 on RCSB PDB site
Description: cis-divalent streptavidin
Class: biotin-binding protein
Keywords: biotin-binding protein, biotin, avidin
Deposited on 2013-07-08, released 2013-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.1614
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered mutation (10)
      • engineered mutation (14)
      • engineered mutation (32)
      • insertion (47)
    Domains in SCOPe 2.07: d4bx5a_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bx5b_
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered mutation (10)
      • engineered mutation (14)
      • engineered mutation (32)
      • insertion (47)
    Domains in SCOPe 2.07: d4bx5c_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bx5d_
  • Heterogens: EDO, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bx5A (A:)
    aeagitgtwyaqlgdtfivtagadgaltgtyeaavgdddgdddgdddgaesryvltgryd
    sapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawk
    stlvghdtftkvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bx5A (A:)
    eagitgtwyaqlgdtfivtagadgaltgtyeaagaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bx5B (B:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bx5B (B:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    s
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bx5C (C:)
    aeagitgtwyaqlgdtfivtagadgaltgtyeaavgdddgdddgdddgaesryvltgryd
    sapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawk
    stlvghdtftkvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bx5C (C:)
    eagitgtwyaqlgdtfivtagadgaltgtyeaagaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4bx5D (D:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bx5D (D:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp