PDB entry 4bx2

View 4bx2 on RCSB PDB site
Description: Crystal Structure of murine Chronophin (Pyridoxal Phosphate Phosphatase) in complex with Beryllium trifluoride
Class: hydrolase
Keywords: hydrolase, pdxp, had phosphatase, had-like hydrolase
Deposited on 2013-07-08, released 2013-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.1702
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyridoxal phosphate phosphatase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60487 (1-End)
      • expression tag (0)
      • conflict (101)
    Domains in SCOPe 2.07: d4bx2a1, d4bx2a2
  • Chain 'B':
    Compound: pyridoxal phosphate phosphatase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60487 (1-End)
      • conflict (101)
    Domains in SCOPe 2.07: d4bx2b_
  • Heterogens: MG, BEF, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bx2A (A:)
    gmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsn
    nsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlpgppdasgavfvlggeglr
    aelraaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhp
    lsdgsrtpgtgslaaavetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletd
    ilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegled
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bx2A (A:)
    gmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsn
    nsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlpgppdasgavfvlggeglr
    aelraaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhp
    lsdgsrtpgtgslaaavetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletd
    ilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bx2B (B:)
    gmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsn
    nsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlpgppdasgavfvlggeglr
    aelraaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhp
    lsdgsrtpgtgslaaavetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletd
    ilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegled
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bx2B (B:)
    marcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsnn
    srrarpelalrfarlgfaglraeqlfssalcaarllrqrlpgppdasgavfvlggeglra
    elraaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhpl
    sdgsrtpgtgslaaavetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletdi
    lfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegl