PDB entry 4bwt

View 4bwt on RCSB PDB site
Description: Three-dimensional structure of Paracoccus pantotrophus pseudoazurin at pH 6.5
Class: electron transport
Keywords: electron transport
Deposited on 2013-07-04, released 2014-07-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.16801
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bwta_
  • Chain 'B':
    Compound: pseudoazurin
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bwtb_
  • Heterogens: CU, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bwtA (A:)
    athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
    nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpkkarermdaela
    qvn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bwtB (B:)
    athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
    nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpkkarermdaela
    qvn