PDB entry 4bwj

View 4bwj on RCSB PDB site
Description: KlenTaq mutant in complex with DNA and ddCTP
Class: transferase/DNA
Keywords: transferase-DNA complex, transferase
Deposited on 2013-07-03, released 2013-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase I, thermostable
    Species: Thermus aquaticus [TaxId:271]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19821 (Start-539)
      • engineered mutation (166)
      • engineered mutation (222)
      • engineered mutation (345)
      • engineered mutation (454)
    Domains in SCOPe 2.07: d4bwja1, d4bwja2
  • Chain 'B':
    Compound: 5'-d(*gp*ap*cp*cp*ap*cp*gp*gp*cp*gp*cp*docp)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
    Gene:
  • Chain 'C':
    Compound: 5'-d(*ap*gp*gp*gp*cp*gp*cp*cp*gp*tp*gp*gp*tp*cp)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
    Gene:
  • Heterogens: DCT, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bwjA (A:)
    aleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargll
    akdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserl
    fanlwgrlegeerllwlyreverplsavlahmeatgvrldvaylramslevaeeiarlea
    evfrlaghpfnlnsrdqlervlfdelglpaigktektgkrstraavlealreahpiveki
    lqyreltklkstyidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgq
    rirrafiaeegwllvaldysqielrvlahlsgdenlirvfqegrdfhtetaswmfgvpre
    avdplmrraaktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektle
    egrrrgyvetlfgrrryvpdlearvksvreaaerkafnmpvqgtaadlmklamvklfprl
    eemgarmllqvhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bwjA (A:)
    leeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkearglla
    kdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlf
    anlwgrlegeerllwlyreverplsavlahmeatgvrldvaylramslevaeeiarleae
    vfrlaghpfnlnsrdqlervlfdelglpaigktektgkrstraavlealreahpivekil
    qyreltklkstyidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqr
    irrafiaeegwllvaldysqielrvlahlsgdenlirvfqegrdfhtetaswmfgvprea
    vdplmrraaktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektlee
    grrrgyvetlfgrrryvpdlearvksvreaaerkafnmpvqgtaadlmklamvklfprle
    emgarmllqvhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.