PDB entry 4bvc

View 4bvc on RCSB PDB site
Description: Identification of small molecule inhibitors selective for apo(a) kringles KIV-7, KIV-10 and KV.
Class: hydrolase
Keywords: hydrolase, lipoprotein(a), cardiovascular disease, drug discovery, optical biosensors
Deposited on 2013-06-25, released 2014-07-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: apolipoprotein(a)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08519 (0-78)
    • engineered mutation (74)
  Domains in SCOPe 2.08: d4bvca_
• Heterogens: CL, BV5, PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4bvcA (A:)
  qcyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgp
  wcftmdpsirweycaltrc