PDB entry 4btn

View 4btn on RCSB PDB site
Description: Multiple LEL structures
Class: immune system
Keywords: immune system, hcv, receptor
Deposited on 2013-06-18, released 2014-07-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.2269
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4btna_
  • Chain 'B':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4btnb_
  • Chain 'C':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4btnc_
  • Chain 'D':
    Compound: CD81 antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4btnd_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4btnA (A:)
    etgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4btnA (A:)
    nkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknnl
    cpsgsniisnlfkedchqkiddlfsgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4btnB (B:)
    etgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4btnB (B:)
    nkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknnl
    cpsgsniisnlfkedchqkiddlfsgk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4btnC (C:)
    etgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4btnC (C:)
    nkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknnl
    cpsgsniisnlfkedchqkiddlfsgk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4btnD (D:)
    etgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
    lknnlcpsgsniisnlfkedchqkiddlfsgkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4btnD (D:)
    nkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknnl
    cpsgsniisnlfkedchqkiddlfsgk