PDB entry 4bsi

View 4bsi on RCSB PDB site
Description: H7N3 Avian Influenza Virus Haemagglutinin in Complex with Avian Receptor Analogue 3'-SLN
Class: viral protein
Keywords: viral protein, h7n3, h7n9, h5n1, influenza, fowl plague virus, sialic acid, glycoprotein, glycosylation, virus receptor, bird flu, sialyllactosamine, 3sln
Deposited on 2013-06-10, released 2013-07-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.21734
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: INFLUENZA VIRUS (A/TURKEY/ITALY/214845/2002 (H7N3)) [TaxId:265120]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4bsia_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: INFLUENZA VIRUS (A/TURKEY/ITALY/214845/2002 (H7N3)) [TaxId:265120]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4bsib_
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bsiA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstt
    eqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqssvqvdancegdcyhsggtiisnlpfqninsravgkcpryv
    kqeslmlatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bsiA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstt
    eqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqssvqvdancegdcyhsggtiisnlpfqninsravgkcpryv
    kqeslmlatgmknvpei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bsiB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhsryreeamqnriqidpvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bsiB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhsryreeamqnr