PDB entry 4bsg

View 4bsg on RCSB PDB site
Description: Crystal Structure of an H7N3 Avian Influenza Virus Haemagglutinin
Class: viral protein
Keywords: viral protein, h7n9, h5n1, fowl plague virus, sialic acid, glycoprotein, glycosylation, virus receptor, bird flu, sialyllactosamine, 3sln, 6sln, lstc, pandemic
Deposited on 2013-06-10, released 2013-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.22541
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: INFLUENZA A (VIRUS A/TURKEY/ITALY/214845/2002 (H7N3)) [TaxId:265120]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bsga_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/TURKEY/ITALY/214845/2002 (H7N3)) [TaxId:265120]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bsgb_
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bsgA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstt
    eqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqssvqvdancegdcyhsggtiisnlpfqninsravgkcpryv
    kqeslmlatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bsgA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstt
    eqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqssvqvdancegdcyhsggtiisnlpfqninsravgkcpryv
    kqeslmlatgmknvpei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bsgB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhsryreeamqnriqidpvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bsgB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhsryreeamqnr