PDB entry 4bse

View 4bse on RCSB PDB site
Description: Human H7N9 Influenza Virus Haemagglutinin in Complex with Human Receptor Analogue LSTc
Class: viral protein
Keywords: viral protein, h7n3, h7n9, h5n1, fowl plague virus, glycoprotein, virus receptor, bird flu, sialyllactosamine, lstc
Deposited on 2013-06-10, released 2013-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.23508
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haemagglutinin ha1
    Species: INFLUENZA VIRUS A/ANHUI/1/2013 (H7N9) [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot M4YV75 (0-End)
      • see remark 999 (216)
    Domains in SCOPe 2.07: d4bsea_
  • Chain 'B':
    Compound: haemagglutinin ha2
    Species: INFLUENZA VIRUS A/ANHUI/1/2013 (H7N9) [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bseb_
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bseA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bseA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bseB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidpvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bseB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr