PDB entry 4bsc

View 4bsc on RCSB PDB site
Description: Human H7N9 Influenza Virus Haemagglutinin (with Asn-133 Glycosylation) in Complex with Human Receptor Analogue 6'-SLN
Class: viral protein
Keywords: viral protein, fowl plague virus, sialyllactosamine
Deposited on 2013-06-10, released 2013-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.22247
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: INFLUENZA VIRUS A/ANHUI/1/2013 (H7N9) [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot M4YV75 (0-End)
      • see remark 999 (9)
      • see remark 999 (124)
      • see remark 999 (216)
    Domains in SCOPe 2.07: d4bsca_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: INFLUENZA VIRUS A/ANHUI/1/2013 (H7N9) [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bscb_
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bscA (A:)
    dkiclghhalsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bscA (A:)
    dkiclghhalsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bscB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidpvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bscB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr