PDB entry 4brx

View 4brx on RCSB PDB site
Description: Focal Adhesion Kinase catalytic domain in complex with a diarylamino- 1,3,5-triazine inhibitor
Class: transferase
Keywords: transferase, kinase inhibitor, ATP-binding, integrin signaling
Deposited on 2013-06-05, released 2013-07-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.1985
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4brxa_
  • Heterogens: KGW, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4brxA (A:)
    strdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflq
    ealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkfsldlaslilyayql
    stalayleskrfvhrdiaarnvlvsatdcvklgdfglsrymedstyykaskgklpikwma
    pesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncppt
    lyslmtkcwaydpsrrprftelkaqlstileeeklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4brxA (A:)
    rdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflqea
    ltmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkfsldlaslilyayqlst
    alayleskrfvhrdiaarnvlvsatdcvklgdfglsrymlpikwmapesinfrrftsasd
    vwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydps
    rrprftelkaqlstileeek