PDB entry 4bq1

View 4bq1 on RCSB PDB site
Description: Crystal structure of of LamAcat from Zobellia galactanivorans
Class: hydrolase
Keywords: marine laminarinase, hydrolase
Deposited on 2013-05-29, released 2013-12-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.139
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,3-beta-glucanase, family gh16
    Species: ZOBELLIA GALACTANIVORANS [TaxId:63186]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L5X4 (8-255)
      • expression tag (5-7)
    Domains in SCOPe 2.06: d4bq1a1, d4bq1a2
  • Chain 'B':
    Compound: endo-1,3-beta-glucanase, family gh16
    Species: ZOBELLIA GALACTANIVORANS [TaxId:63186]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L5X4 (8-255)
      • expression tag (5-7)
    Domains in SCOPe 2.06: d4bq1b1, d4bq1b2
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bq1A (A:)
    hhhhhhgsafntlvfsdefeyegkpdpekwhyqvippnngswhnnelqhytnrsensfvs
    dgtlkiraikekytfegstkdytsarlnskfaftygkvevraklpskkgtwpaiwtlgan
    snetgnyfgeqygnaewpacgeidileqngwdkestiahfhwsdlnsdeyqnlggttpit
    nasgsfhvyslewnasamkvflddtlvyelknsqntpynaphylllniamggtlggdipe
    nftddifeidyvriyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bq1A (A:)
    hgsafntlvfsdefeyegkpdpekwhyqvippnngswhnnelqhytnrsensfvsdgtlk
    iraikekytfegstkdytsarlnskfaftygkvevraklpskkgtwpaiwtlgansnetg
    nyfgeqygnaewpacgeidileqngwdkestiahfhwsdlnsdeyqnlggttpitnasgs
    fhvyslewnasamkvflddtlvyelknsqntpynaphylllniamggtlggdipenftdd
    ifeidyvriyq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bq1B (B:)
    hhhhhhgsafntlvfsdefeyegkpdpekwhyqvippnngswhnnelqhytnrsensfvs
    dgtlkiraikekytfegstkdytsarlnskfaftygkvevraklpskkgtwpaiwtlgan
    snetgnyfgeqygnaewpacgeidileqngwdkestiahfhwsdlnsdeyqnlggttpit
    nasgsfhvyslewnasamkvflddtlvyelknsqntpynaphylllniamggtlggdipe
    nftddifeidyvriyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bq1B (B:)
    hgsafntlvfsdefeyegkpdpekwhyqvippnngswhnnelqhytnrsensfvsdgtlk
    iraikekytfegstkdytsarlnskfaftygkvevraklpskkgtwpaiwtlgansnetg
    nyfgeqygnaewpacgeidileqngwdkestiahfhwsdlnsdeyqnlggttpitnasgs
    fhvyslewnasamkvflddtlvyelknsqntpynaphylllniamggtlggdipenftdd
    ifeidyvriyq