PDB entry 4bq0

View 4bq0 on RCSB PDB site
Description: Pseudomonas aeruginosa beta-alanine:pyruvate aminotransferase holoenzyme without divalent cations on dimer-dimer interface
Class: transferase
Keywords: transferase, pseudo-translation
Deposited on 2013-05-29, released 2013-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.21886
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-alanine--pyruvate transaminase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bq0a_
  • Chain 'B':
    Compound: beta-alanine--pyruvate transaminase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bq0b_
  • Chain 'C':
    Compound: beta-alanine--pyruvate transaminase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bq0c_
  • Chain 'D':
    Compound: beta-alanine--pyruvate transaminase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bq0d_
  • Heterogens: CL, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bq0A (A:)
    mnqplnvappvsselnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsgl
    wtcgaghsrkeiqeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsg
    secadtsikmaraywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvd
    hlphtlqpgmaftrgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvg
    ylqrlreicdqhnillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgav
    iasseiydtfmnqalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaph
    fekglhglqgaknvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtl
    qfgptfnarpeeldrlfdavgealngia
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bq0A (A:)
    pvsselnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsglwtcgaghsr
    keiqeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsgsecadtsik
    maraywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvdhlphtlqpg
    maftrgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvgylqrlreic
    dqhnillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgaviasseiydt
    fmnqalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaphfekglhglq
    gaknvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtlqfgptfnar
    peeldrlfdavgealngia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bq0B (B:)
    mnqplnvappvsselnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsgl
    wtcgaghsrkeiqeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsg
    secadtsikmaraywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvd
    hlphtlqpgmaftrgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvg
    ylqrlreicdqhnillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgav
    iasseiydtfmnqalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaph
    fekglhglqgaknvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtl
    qfgptfnarpeeldrlfdavgealngia
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bq0B (B:)
    selnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsglwtcgaghsrkei
    qeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsgsecadtsikmar
    aywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvdhlphtlqpgmaf
    trgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvgylqrlreicdqh
    nillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgaviasseiydtfmn
    qalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaphfekglhglqgak
    nvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtlqfgptfnarpee
    ldrlfdavgealngia
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bq0C (C:)
    mnqplnvappvsselnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsgl
    wtcgaghsrkeiqeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsg
    secadtsikmaraywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvd
    hlphtlqpgmaftrgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvg
    ylqrlreicdqhnillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgav
    iasseiydtfmnqalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaph
    fekglhglqgaknvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtl
    qfgptfnarpeeldrlfdavgealngia
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bq0C (C:)
    elnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsglwtcgaghsrkeiq
    eavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsgsecadtsikmara
    ywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvdhlphtlqpgmaft
    rgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvgylqrlreicdqhn
    illifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgaviasseiydtfmnq
    alpehavefshgytysahpvacaaglaaldilardnlvqqsaelaphfekglhglqgakn
    vidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtlqfgptfnarpeel
    drlfdavgealngia
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4bq0D (D:)
    mnqplnvappvsselnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsgl
    wtcgaghsrkeiqeavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsg
    secadtsikmaraywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvd
    hlphtlqpgmaftrgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvg
    ylqrlreicdqhnillifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgav
    iasseiydtfmnqalpehavefshgytysahpvacaaglaaldilardnlvqqsaelaph
    fekglhglqgaknvidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtl
    qfgptfnarpeeldrlfdavgealngia
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bq0D (D:)
    elnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsglwtcgaghsrkeiq
    eavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsgsecadtsikmara
    ywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvdhlphtlqpgmaft
    rgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvgylqrlreicdqhn
    illifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgaviasseiydtfmnq
    alpehavefshgytysahpvacaaglaaldilardnlvqqsaelaphfekglhglqgakn
    vidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtlqfgptfnarpeel
    drlfdavgealngia