PDB entry 4bpr

View 4bpr on RCSB PDB site
Description: ferredoxin-nadp reductase mutant with tyr 79 replaced by phe (y79f)
Class: oxidoreductase
Keywords: oxidoreductase, flavoprotein
Deposited on 2013-05-28, released 2013-11-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18919
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin-nadp reductase
    Species: ANABAENA SP. [TaxId:1167]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21890 (Start-302)
      • engineered mutation (78)
      • conflict (245)
    Domains in SCOPe 2.03: d4bpra1, d4bpra2
  • Heterogens: FAD, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bprA (A:)
    tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
    giippgvdkngkpeklrlfsiastrhgddvddktislcvrqleykhpesgetvygvcsty
    lthiepgsevkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpe
    yqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrv
    aehadqlwqliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhv
    ety
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bprA (A:)
    dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
    kngkpeklrlfsiastrhgddvddktislcvrqleykhptvygvcstylthiepgsevki
    tgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfg
    vpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqlik
    nqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety