PDB entry 4bpf

View 4bpf on RCSB PDB site
Description: High resolution crystal structure of Bacillus subtilis DltC S36A
Class: ligase
Keywords: ligase, lipoteichoic acid, d-alanylation, peptidyl-carrier-protein, acyl-carrier-protein
Deposited on 2013-05-26, released 2014-06-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: XRAY
Resolution: 1.01 Å
R-factor: N/A
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine--poly(phosphoribitol) ligase subunit 2
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39579 (0-77)
      • expression tag (78-85)
      • engineered mutation (35)
    Domains in SCOPe 2.07: d4bpfa1, d4bpfa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bpfA (A:)
    mdfkqevldvlaevcqddivkenpdieifeeglldafgtvelllaienrfdilvpitefd
    rdvwntpnnivnqlselkrshhhhhh