PDB entry 4bp2

View 4bp2 on RCSB PDB site
Description: crystallographic refinement of bovine pro-phospholipase a2 at 1.6 angstroms resolution
Class: carboxylic ester hydrolase zymogen
Keywords: carboxylic ester hydrolase zymogen
Deposited on 1990-09-07, released 1991-10-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.19
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4bp2a_
  • Heterogens: CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4bp2A (A:)
qaglnsralwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncyk
qakkldsckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynk
ehknldkknc

    Sequence, based on observed residues (ATOM records): (download) 
    >4bp2A (A:)
alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqakklds
ckvlnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldkknc