PDB entry 4bp2

View 4bp2 on RCSB PDB site
Description: crystallographic refinement of bovine pro-phospholipase a2 at 1.6 angstroms resolution
Class: carboxylic ester hydrolase zymogen
Keywords: carboxylic ester hydrolase zymogen
Deposited on 1990-09-07, released 1991-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bp2a_
  • Heterogens: CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bp2A (A:)
    qaglnsralwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncyk
    qakkldsckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynk
    ehknldkknc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bp2A (A:)
    alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqakklds
    ckvlnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldkknc