PDB entry 4bow

View 4bow on RCSB PDB site
Description: Crystal structure of LamA_E269S from Z. galactanivorans in complex with laminaritriose and laminaritetraose
Class: hydrolase
Keywords: hydrolase, marine laminarinase, family gh16 glycoside hydrolase
Deposited on 2013-05-22, released 2013-12-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.13184
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,3-beta-glucanase, family gh16
    Species: ZOBELLIA GALACTANIVORANS [TaxId:63186]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L5X4 (8-255)
      • engineered mutation (141)
    Domains in SCOPe 2.06: d4bowa_
  • Chain 'B':
    Compound: endo-1,3-beta-glucanase, family gh16
    Species: ZOBELLIA GALACTANIVORANS [TaxId:63186]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L5X4 (8-255)
      • engineered mutation (141)
    Domains in SCOPe 2.06: d4bowb_
  • Heterogens: CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bowA (A:)
    hhhhhhgsafntlvfsdefeyegkpdpekwhyqvippnngswhnnelqhytnrsensfvs
    dgtlkiraikekytfegstkdytsarlnskfaftygkvevraklpskkgtwpaiwtlgan
    snetgnyfgeqygnaewpacgsidileqngwdkestiahfhwsdlnsdeyqnlggttpit
    nasgsfhvyslewnasamkvflddtlvyelknsqntpynaphylllniamggtlggdipe
    nftddifeidyvriyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bowA (A:)
    afntlvfsdefeyegkpdpekwhyqvippnngswhnnelqhytnrsensfvsdgtlkira
    ikekytfegstkdytsarlnskfaftygkvevraklpskkgtwpaiwtlgansnetgnyf
    geqygnaewpacgsidileqngwdkestiahfhwsdlnsdeyqnlggttpitnasgsfhv
    yslewnasamkvflddtlvyelknsqntpynaphylllniamggtlggdipenftddife
    idyvriyq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bowB (B:)
    hhhhhhgsafntlvfsdefeyegkpdpekwhyqvippnngswhnnelqhytnrsensfvs
    dgtlkiraikekytfegstkdytsarlnskfaftygkvevraklpskkgtwpaiwtlgan
    snetgnyfgeqygnaewpacgsidileqngwdkestiahfhwsdlnsdeyqnlggttpit
    nasgsfhvyslewnasamkvflddtlvyelknsqntpynaphylllniamggtlggdipe
    nftddifeidyvriyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bowB (B:)
    afntlvfsdefeyegkpdpekwhyqvippnngswhnnelqhytnrsensfvsdgtlkira
    ikekytfegstkdytsarlnskfaftygkvevraklpskkgtwpaiwtlgansnetgnyf
    geqygnaewpacgsidileqngwdkestiahfhwsdlnsdeyqnlggttpitnasgsfhv
    yslewnasamkvflddtlvyelknsqntpynaphylllniamggtlggdipenftddife
    idyvriyq