PDB entry 4bnz

View 4bnz on RCSB PDB site
Description: Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (FabG) from Pseudomonas aeruginosa in complex with 1-methyl-N-phenylindole- 3-carboxamide at 2.5A resolution
Class: oxidoreductase
Keywords: oxidoreductase, rossmann fold, fatty acid biosynthesis
Deposited on 2013-05-17, released 2013-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.20298
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase FabG
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54438 (22-268)
      • expression tag (20-21)
    Domains in SCOPe 2.07: d4bnza1, d4bnza2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase FabG
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54438 (22-268)
      • expression tag (16-21)
    Domains in SCOPe 2.07: d4bnzb1, d4bnzb2
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase FabG
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54438 (22-268)
      • expression tag (2-8)
      • expression tag (16-21)
    Domains in SCOPe 2.07: d4bnzc1, d4bnzc2
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase FabG
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54438 (22-268)
      • expression tag (17-21)
    Domains in SCOPe 2.07: d4bnzd1, d4bnzd2
  • Heterogens: 8M5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bnzA (A:)
    mhhhhhhssgvdlgtenlyfqsmslqgkvalvtgasrgigqaialelgrlgavvigtats
    asgaekiaetlkangvegaglvldvssdesvaatlehiqqhlgqplivvnnagitrdnll
    vrmkddewfdvvntnlnslyrlskavlrgmtkarwgriinigsvvgamgnagqtnyaaak
    aglegftralarevgsraitvnavapgfidtdmtrelpeaqreallgqiplgrlgqaeei
    akvvgflasdgaayvtgatvpvnggmyms
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bnzA (A:)
    qsmslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangvegag
    lvldvssdesvaatlehiqqhlgqplivvnnagrmkddewfdvvntnlnslyrlskavlr
    gmtkarwgriinigsvvgamgnagqtnyaaakaglegftralarevgsraitvnavapgf
    idtdmtrelpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpvnggmym
    s
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bnzB (B:)
    mhhhhhhssgvdlgtenlyfqsmslqgkvalvtgasrgigqaialelgrlgavvigtats
    asgaekiaetlkangvegaglvldvssdesvaatlehiqqhlgqplivvnnagitrdnll
    vrmkddewfdvvntnlnslyrlskavlrgmtkarwgriinigsvvgamgnagqtnyaaak
    aglegftralarevgsraitvnavapgfidtdmtrelpeaqreallgqiplgrlgqaeei
    akvvgflasdgaayvtgatvpvnggmyms
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bnzB (B:)
    nlyfqsmslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangv
    egaglvldvssdesvaatlehiqqhlgqplivvnnagitrddewfdvvntnlnslyrlsk
    avlrgmtkarwgriinigsvvagqtnyaaakaglegftralarevgsraitvnavapgfi
    dtdmtrelpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpvnggmyms
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4bnzC (C:)
    mhhhhhhssgvdlgtenlyfqsmslqgkvalvtgasrgigqaialelgrlgavvigtats
    asgaekiaetlkangvegaglvldvssdesvaatlehiqqhlgqplivvnnagitrdnll
    vrmkddewfdvvntnlnslyrlskavlrgmtkarwgriinigsvvgamgnagqtnyaaak
    aglegftralarevgsraitvnavapgfidtdmtrelpeaqreallgqiplgrlgqaeei
    akvvgflasdgaayvtgatvpvnggmyms
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bnzC (C:)
    hhhhhssnlyfqsmslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiae
    tlkangvegaglvldvssdesvaatlehiqqhlgqplivvnnagdewfdvvntnlnslyr
    lskavlrgmtkarwgriinigsvvgamgnagqtnyaaakaglegftralarevgsraitv
    navapgfidtdmtrelpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvp
    vnggmyms
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4bnzD (D:)
    mhhhhhhssgvdlgtenlyfqsmslqgkvalvtgasrgigqaialelgrlgavvigtats
    asgaekiaetlkangvegaglvldvssdesvaatlehiqqhlgqplivvnnagitrdnll
    vrmkddewfdvvntnlnslyrlskavlrgmtkarwgriinigsvvgamgnagqtnyaaak
    aglegftralarevgsraitvnavapgfidtdmtrelpeaqreallgqiplgrlgqaeei
    akvvgflasdgaayvtgatvpvnggmyms
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bnzD (D:)
    lyfqsmslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangve
    gaglvldvssdesvaatlehiqqhlgqplivvnnagitvrmkddewfdvvntnlnslyrl
    skavlrgmtkarwgriinigsvvgamgnagqtnyaaakaglegftralarevgsraitvn
    avapgfidtdmtrelpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpv
    nggmyms