PDB entry 4bnr

View 4bnr on RCSB PDB site
Description: Extremely stable complex of crayfish trypsin with bovine trypsin inhibitor
Class: hydolase/inhibitor
Keywords: hydolase-inhibitor complex, protease, inhibition, arthropoda, heat stability, complex formation
Deposited on 2013-05-17, released 2013-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1511
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hepatopancreas trypsin
    Species: PONTASTACUS LEPTODACTYLUS [TaxId:6717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q52V24 (0-236)
      • conflict (46)
    Domains in SCOPe 2.07: d4bnra_
  • Chain 'B':
    Compound: hepatopancreas trypsin
    Species: PONTASTACUS LEPTODACTYLUS [TaxId:6717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q52V24 (0-236)
      • conflict (46)
    Domains in SCOPe 2.07: d4bnrb_
  • Chain 'I':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bnri_
  • Chain 'J':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bnrj_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bnrA (A:)
    ivggtdatlgefpyqlsfqetfigfsfhfcgasiynenyaitaghcvygddyenpsglqi
    vageldmsvnegseqiitvskiilhenfdynlldndisllklsgsltfndnvapialpeq
    ghtatgdvivtgwgttseggntpdvlqkvtvplvsdedcradygadeildsmicagvpeg
    gkdscqgdsggplaasdtgstylagivswgygcarpgypgvytevsyhvdwikanav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bnrB (B:)
    ivggtdatlgefpyqlsfqetfigfsfhfcgasiynenyaitaghcvygddyenpsglqi
    vageldmsvnegseqiitvskiilhenfdynlldndisllklsgsltfndnvapialpeq
    ghtatgdvivtgwgttseggntpdvlqkvtvplvsdedcradygadeildsmicagvpeg
    gkdscqgdsggplaasdtgstylagivswgygcarpgypgvytevsyhvdwikanav
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4bnrI (I:)
    mkmsrlclsvallvllgtlaastpgcdtsnqakaqrpdfcleppytgpckariiryfyna
    kaglcqtfvyggcrakrnnfksaedcmrtcggaigpwenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bnrI (I:)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcggai
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4bnrJ (J:)
    mkmsrlclsvallvllgtlaastpgcdtsnqakaqrpdfcleppytgpckariiryfyna
    kaglcqtfvyggcrakrnnfksaedcmrtcggaigpwenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bnrJ (J:)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcggai