PDB entry 4bnq

View 4bnq on RCSB PDB site
Description: The structure of the Staphylococcus aureus Ham1 protein
Class: hydrolase
Keywords: hydrolase, ham, inosine triphosphate pyrophosphatase
Deposited on 2013-05-16, released 2013-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.1908
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-canonical purine NTP pyrophosphatase
    Species: STAPHYLOCOCCUS AUREUS SUBSP. AUREUS [TaxId:46170]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bnqa_
  • Chain 'B':
    Compound: Non-canonical purine NTP pyrophosphatase
    Species: STAPHYLOCOCCUS AUREUS SUBSP. AUREUS [TaxId:46170]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4bnqb_
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bnqA (A:)
    mkeiviasnnqgkindfkvifpdyhvigiselipdfdveetgstfeenailkseaaakal
    nktviaddsglevfalngepgiysaryagenksdeaniekllnklgnttdrraqfvcvis
    msgpdmetkvfkgtvsgeiadgkygengfgydpifyvpkldktmaqlskeqkgqishrrn
    ainllqaflegeknv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bnqA (A:)
    keiviasnnqgkindfkvifpdyhvigiselipdfdveetgstfeenailkseaaakaln
    ktviaddsglevfalngepgiysaryagenksdeaniekllnklgnttdrraqfvcvism
    sgpdmetkvfkgtvsgeiadgkygengfgydpifyvpkldktmaqlskeqkgqishrrna
    inllqaflegeknv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bnqB (B:)
    mkeiviasnnqgkindfkvifpdyhvigiselipdfdveetgstfeenailkseaaakal
    nktviaddsglevfalngepgiysaryagenksdeaniekllnklgnttdrraqfvcvis
    msgpdmetkvfkgtvsgeiadgkygengfgydpifyvpkldktmaqlskeqkgqishrrn
    ainllqaflegeknv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bnqB (B:)
    keiviasnnqgkindfkvifpdyhvigiselipdfdveetgstfeenailkseaaakaln
    ktviaddsglevfalngepgiysaryagenksdeaniekllnklgnttdrraqfvcvism
    sgpdmetkvfkgtvsgeiadgkygengfgydpifyvpkldktmaqlskeqkgqishrrna
    inllqaflegekn