PDB entry 4bnp

View 4bnp on RCSB PDB site
Description: 3D structure of E. coli Isocitrate Dehydrogenase K100M mutant in complex with isocitrate and magnesium(II)
Class: oxidoreductase
Keywords: oxidoreductase, oxidative beta-decarboxylation
Deposited on 2013-05-16, released 2014-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isocitrate dehydrogenase [NADP]
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08200 (Start-415)
      • engineered mutation (99)
    Domains in SCOPe 2.07: d4bnpa_
  • Heterogens: ICT, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bnpA (A:)
    meskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykge
    rkiswmeiytgekstqvygqdvwlpaetldlireyrvaimgplttpvgggirslnvalrq
    eldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflr
    eemgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftega
    fkdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydvia
    cmnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsa
    emmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bnpA (A:)
    eskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykger
    kiswmeiytgekstqvygqdvwlpaetldlireyrvaimgplttpvgggirslnvalrqe
    ldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflre
    emgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegaf
    kdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviac
    mnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsae
    mmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm