PDB entry 4bnd

View 4bnd on RCSB PDB site
Description: Structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases
Class: isomerase
Keywords: isomerase, substrate specificity, phosphoglucose interconversion
Deposited on 2013-05-14, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.157
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-phosphoglucomutase
    Species: LACTOCOCCUS LACTIS SUBSP. CREMORIS MG1363 [TaxId:416870]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00G41 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d4bnda1, d4bnda2
  • Chain 'B':
    Compound: alpha-phosphoglucomutase
    Species: LACTOCOCCUS LACTIS SUBSP. CREMORIS MG1363 [TaxId:416870]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00G41 (1-252)
      • expression tag (0)
    Domains in SCOPe 2.07: d4bndb1, d4bndb2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bndA (A:)
    kmkkilsfdidntlnepkmpifpemaellatlsqkyiiapisgqkydqfliqiinnlpes
    anldnfhlfvaqgtqyyahkagewkqvfnyaltdeqanaimgalekaakelghwdesvll
    pgdeinenresmiaysaigqkagveakqawdpdmtkrneiaklasqyapefefevagttt
    ingfvpgqnkefgmnhlmeelnvtkeeilyfgdmtqpggndypvvqmgietitvrdwket
    aailkaiiameea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bndA (A:)
    kmkkilsfdidntlnepkmpifpemaellatlsqkyiiapisgqkydqfliqiinnlpes
    anldnfhlfvaqgtqyyahkagewkqvfnyaltdeqanaimgalekaakelghwdesvll
    pgdeinenresmiaysaigqkagveakqawdpdmtkrneiaklasqyapefefevagttt
    ingfvpgqnkefgmnhlmeelnvtkeeilyfgdmtqpggndypvvqmgietitvrdwket
    aailkaiiamee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bndB (B:)
    amkkilsfdidntlnepkmpifpemaellatlsqkyiiapisgqkydqfliqiinnlpes
    anldnfhlfvaqgtqyyahkagewkqvfnyaltdeqanaimgalekaakelghwdesvll
    pgdeinenresmiaysaigqkagveakqawdpdmtkrneiaklasqyapefefevagttt
    ingfvpgqnkefgmnhlmeelnvtkeeilyfgdmtqpggndypvvqmgietitvrdwket
    aailkaiiameea