PDB entry 4bme

View 4bme on RCSB PDB site
Description: Crystal structure of the N terminal domain of human Galectin 8, F19Y mutant
Class: sugar binding protein
Keywords: sugar binding protein, carbohydrate recognition
Deposited on 2013-05-07, released 2014-03-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1965
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214 (Start-151)
      • engineered mutation (15)
    Domains in SCOPe 2.05: d4bmea_
  • Chain 'B':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214
      • engineered mutation (15)
    Domains in SCOPe 2.05: d4bmeb_
  • Heterogens: LBT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bmeA (A:)
    slnnlqniiynpvipyvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradva
    fhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkht
    llyghrigpekidtlgiygkvnihsigfsfss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bmeA (A:)
    nlqniiynpvipyvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradvafhf
    nprfkgcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtllygh
    rigpekidtlgiygkvnihsigfsfss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bmeB (B:)
    slnnlqniiynpvipyvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradva
    fhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkht
    llyghrigpekidtlgiygkvnihsigfsfss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bmeB (B:)
    nlqniiynpvipyvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradvafhf
    nprfkragcivcntlinekwgreeitytpfkreksfeivimvlkdkfqvavngkhtllyg
    hrigpekidtlgiygkvnihsigfsf