PDB entry 4bmb

View 4bmb on RCSB PDB site
Description: Crystal structure of the N terminal domain of human Galectin 8
Class: sugar binding protein
Keywords: sugar binding protein, carbohydrate recognition
Deposited on 2013-05-07, released 2014-03-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.1595
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4bmba_
  • Heterogens: ZN, LAT, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bmbA (A:)
    slnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradva
    fhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkht
    llyghrigpekidtlgiygkvnihsigfsf